PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.4082s0018.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family Trihelix
Protein Properties Length: 329aa    MW: 38757.2 Da    PI: 6.6245
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.4082s0018.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix75.77.7e-2453135186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          +W+ +e+++L+ +r+e+++++ ++k++k lWe v++km+++ f rs++qCk+kw+nl +ryk+++++e +     ++++p++++++
  Cagra.4082s0018.1.p  53 QWSIEETKELLGIREELDQTFMETKRNKLLWEVVAAKMADKAFVRSAEQCKSKWKNLVTRYKACETTEADA---IRQHFPFYNEIQ 135
                          7********************************************************************95...55679***9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.009450112IPR001005SANT/Myb domain
CDDcd122036.23E-2052114No hitNo description
PfamPF138372.1E-1953137No hitNo description
PROSITE profilePS500907.88654110IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MDRRNPFQHH HHHHQLHHHL IQQQQLPPPP QSTTAAMDLG GGGGGGGGER IPQWSIEETK  60
ELLGIREELD QTFMETKRNK LLWEVVAAKM ADKAFVRSAE QCKSKWKNLV TRYKACETTE  120
ADAIRQHFPF YNEIQSIFAA RMQRMLWSEA TEPSTSSKRK HNQFSSDEEE EEEEEADEPN  180
QEINEELLSL VETQKKETEV MTTSVSTNPR KRAKKGKGVA KAETAGSTIK EVLEEFMRQT  240
VKMEKEWRDA WEMKEREREK REREWRRRMA ELEEERAAAE RRWMEREEER RLREEARAQK  300
RDTLIDALLN KFNRDHNNDH HHGHSQGF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2716770.0AY271677.1 Arabidopsis thaliana transcription factor GT-3a (GT3A) mRNA, complete cds.
GenBankBT0289260.0BT028926.1 Arabidopsis thaliana At5g01380 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288194.10.0hypothetical protein CARUB_v10001432mg
SwissprotQ9SDW01e-153TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLR0FFS40.0R0FFS4_9BRAS; Uncharacterized protein
STRINGAT5G01380.11e-151(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.11e-109Trihelix family protein